PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000649.1.g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 563aa    MW: 61167.3 Da    PI: 4.9407
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000649.1.g00006.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-173986148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    +g+WTt Ed +l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  FANhyb_rscf00000649.1.g00006.1 39 KGPWTTAEDTILKEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 86
                                    79******************************************9986 PP

2Myb_DNA-binding53.36.2e-1792135146
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                     +g++T+eE+ l+v++++++G++ W++ a++++ gRt++++k++w++
  FANhyb_rscf00000649.1.g00006.1  92 KGAFTPEEERLIVELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                                     799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0493486IPR017930Myb domain
SuperFamilySSF466893.56E-3038133IPR009057Homeodomain-like
SMARTSM007172.2E-153888IPR001005SANT/Myb domain
PfamPF002491.8E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-234093IPR009057Homeodomain-like
CDDcd001677.81E-124186No hitNo description
PROSITE profilePS5129426.71187141IPR017930Myb domain
SMARTSM007173.4E-1791139IPR001005SANT/Myb domain
PfamPF002498.6E-1692135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-2694140IPR009057Homeodomain-like
CDDcd001671.37E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MSRTTSDSED GMLSKDQIES PLMDENNGGI GNGGIILKKG PWTTAEDTIL KEYVKKHGEG  60
NWNAVQKHSG LFRCGKSCRL RWANHLRPNL KKGAFTPEEE RLIVELHAKM GNKWARMAAH  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP ELSLQASQES QQGHSGGALN GTDRAHHDSL  180
QSNSYEIPDV VFDSLKGNNC VLPYVPELPD ISASGMLMKG LGSSPYCGFM PPTMHRQKRP  240
RESTALFPTS GGSFIDGFPQ FDQYENDACD KVARPFGLPF LPDPDPTTKS PLSFGVIQGC  300
HSLSNGNFSA CRPTCGAVKL ELPSLQYPET DLGSWSTSPP PPPLLESIDN FIQSPPPVGV  360
FESDYASPRN SGLLDALLYE SKTLSSTKNH STDKSSNSSS VTPGEVADSS TLNVCETEWE  420
ECGDPISPLG HSATSLFSEC TPISASGSSL EEAPPAETLT GSNVKPEPAD HAWTPEKQKE  480
SSPPLDYIRP DALLGSDWLE PSTGIKDQSI MNMNDAIVSL LGEDLVTEYK HMASGTSTSN  540
QGWGLGSCPW NNMPAVCQMT DLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31371405107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011468770.10.0PREDICTED: transcription factor GAMYB
TrEMBLM5X3T10.0M5X3T1_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-124myb domain protein 33